ING4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ING4 partial ORF ( NP_057246.2, 73 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKSRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ING4
Entrez GeneID
51147GeneBank Accession#
NM_016162Protein Accession#
NP_057246.2Gene Name
ING4
Gene Alias
MGC12557, my036, p29ING4
Gene Description
inhibitor of growth family, member 4
Omim ID
608524Gene Ontology
HyperlinkGene Summary
This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq
Other Designations
brain my036 protein|candidate tumor suppressor p33 ING1 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com