HSD17B12 monoclonal antibody (M08), clone 4G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in human ovarian cancer.
Western Blot (Cell lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in PC-12.
Western Blot (Cell lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in NIH/3T3.
Western Blot (Cell lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in Jurkat(Cat # L017V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSD17B12 is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HSD17B12.
Immunogen
HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in human ovarian cancer.Western Blot (Cell lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in PC-12.Western Blot (Cell lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in NIH/3T3.Western Blot (Cell lysate)
HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in Jurkat(Cat # L017V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSD17B12 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — HSD17B12
Entrez GeneID
51144GeneBank Accession#
NM_016142Protein Accession#
NP_057226Gene Name
HSD17B12
Gene Alias
KAR, SDR12C1
Gene Description
hydroxysteroid (17-beta) dehydrogenase 12
Omim ID
609574Gene Ontology
HyperlinkGene Summary
The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM
Other Designations
17beta-HSD type 12|3-ketoacyl-CoA reductase|short chain dehydrogenase/reductase family 12C, member 1|steroid dehydrogenase homolog
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com