Product Browser

Last updated: 2017/7/16
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B12 polyclonal antibody (A01)

  • Catalog # : H00051144-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HSD17B12.
  • Immunogen:
  • HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051144-A01
    Western Blot detection against Immunogen (33.7 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HSD17B12 polyclonal antibody (A01), Lot # 060803QCS1. Western Blot analysis of HSD17B12 expression in SJCRH30.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HSD17B12 polyclonal antibody (A01), Lot # 051122JCO1 Western Blot analysis of HSD17B12 expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HSD17B12
  • Gene Alias:
  • KAR,SDR12C1
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 12
  • Gene Summary:
  • The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM
  • Other Designations:
  • 17beta-HSD type 12,3-ketoacyl-CoA reductase,short chain dehydrogenase/reductase family 12C, member 1,steroid dehydrogenase homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook