Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

INSIG2 (Human) Recombinant Protein (P01)

  • Catalog # : H00051141-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human INSIG2 full-length ORF ( AAH22475, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAEGETEPPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQPLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAVYECKVIAEKSHQE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50.49
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051141-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • INSIG2
  • Gene Alias:
  • MGC26273
  • Gene Description:
  • insulin induced gene 2
  • Gene Summary:
  • The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq
  • Other Designations:
  • INSIG2 membrane protein,insulin induced protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook