RNF12 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RNF12 partial ORF ( NP_057204, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.87
Interspecies Antigen Sequence
Mouse (85); Rat (86)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RNF12
Entrez GeneID
51132GeneBank Accession#
NM_016120Protein Accession#
NP_057204Gene Name
RNF12
Gene Alias
MGC15161, NY-REN-43, RLIM
Gene Description
ring finger protein 12
Omim ID
300379Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be an E3 ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
LIM domain interacting ring finger protein|OTTHUMP00000023574|OTTHUMP00000023575|ring zinc finger LIM domain binding protein|ring zinc finger protein NY-REN-43antigen
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com