RNF12 monoclonal antibody (M01), clone 1G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF12.
Immunogen
RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RNF12 monoclonal antibody (M01), clone 1G10. Western Blot analysis of RNF12 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody (M01), clone 1G10.
Lane 1: RNF12 transfected lysate (Predicted MW: 68.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of RNF12 transfected lysate using anti-RNF12 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF12 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF12 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RNF12
Entrez GeneID
51132GeneBank Accession#
NM_016120Protein Accession#
NP_057204Gene Name
RNF12
Gene Alias
MGC15161, NY-REN-43, RLIM
Gene Description
ring finger protein 12
Omim ID
300379Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be an E3 ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
LIM domain interacting ring finger protein|OTTHUMP00000023574|OTTHUMP00000023575|ring zinc finger LIM domain binding protein|ring zinc finger protein NY-REN-43antigen
-
Interactome
-
Publication Reference
-
Round Spermatid Injection Rescues Female Lethality of a Paternally Inherited Xist Deletion in Mouse.
Federici F, Magaraki A, Wassenaar E, van Veen-Buurman CJ, van de Werken C, Baart EB, Laven JS, Grootegoed JA, Gribnau J, Baarends WM.
PLoS Genetics 2016 Oct; 12(10):e1006358.
Application:IF, Mouse, Embryo.
-
E3 Ubiquitin Ligase RLIM Negatively Regulates c-Myc Transcriptional Activity and Restrains Cell Proliferation.
Gao R, Wang L, Cai H, Zhu J, Yu L.
PLoS One 2016 Sep; 11(9):e0164086.
Application:IP-WB, Human, HEK 293T, H1299, U2OS cells.
-
The role of maternal-specific H3K9me3 modification in establishing imprinted X-chromosome inactivation and embryogenesis in mice.
Fukuda A, Tomikawa J, Miura T, Hata K, Nakabayashi K, Eggan K, Akutsu H, Umezawa A.
Nature Communications 2014 Nov; 5:5464.
Application:IF, Mouse, Oocytes injection si-control PEs or si-Rnf12 PEs.
-
Nuclear receptor NR4A1 promotes breast cancer invasion and metastasis by activating TGF-β signalling.
Zhou F, Drabsch Y, Dekker TJ, de Vinuesa AG, Li Y, Hawinkels LJ, Sheppard KA, Goumans MJ, Luwor RB, de Vries CJ, Mesker WE, Tollenaar RA, Devilee P, Lu CX, Zhu H, Zhang L, Dijke PT.
Nature Communications 2014 Mar; 5:3388.
Application:WB-Tr, Human, HEK 293T cells.
-
Round Spermatid Injection Rescues Female Lethality of a Paternally Inherited Xist Deletion in Mouse.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com