TRIM17 monoclonal antibody (M01), clone 2E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM17.
Immunogen
TRIM17 (NP_057186.1, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRER
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIM17 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIM17 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TRIM17
Entrez GeneID
51127GeneBank Accession#
NM_016102Protein Accession#
NP_057186.1Gene Name
TRIM17
Gene Alias
RBCC, RNF16, terf
Gene Description
tripartite motif-containing 17
Omim ID
606123Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
RING finger protein terf|ring finger protein 16|testis RING finger protein
-
Interactome
-
Disease
-
Publication Reference
-
CCL17 exerts neuroprotection through activation of CCR4/mTORC2 axis in microglia after subarachnoid haemorrhage in rats.
Anke Zhang, Yibo Liu, Houshi Xu, Zeyu Zhang, Xiaoyu Wang, Ling Yuan, Cameron Lenahan, Chuan Zhang, Junkun Jiang, Chaoyou Fang, Yuanjian Fang, Jianmin Zhang, Sheng Chen.
Stroke and Vascular Neurology 2022 Jul; 8(1):4.
Application:IF, WB-Ti, Mouse, Mouse cortex, Mouse neurons.
-
TRIM17 and TRIM28 antagonistically regulate the ubiquitination and anti-apoptotic activity of BCL2A1.
Lionnard L, Duc P, Brennan MS, Kueh AJ, Pal M, Guardia F, Mojsa B, Damiano MA, Mora S, Lassot I, Ravichandran R, Cochet C, Aouacheria A, Potts PR, Herold MJ, Desagher S, Kucharczak J.
Cell Death and Differentiation 2018 Jul; [Epub].
Application:PLA, Human, SK-MEL-28 cells.
-
CCL17 exerts neuroprotection through activation of CCR4/mTORC2 axis in microglia after subarachnoid haemorrhage in rats.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com