NAT5 monoclonal antibody (M01), clone 2C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NAT5.
Immunogen
NAT5 (AAH05181, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.32 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NAT5 monoclonal antibody (M01), clone 2C6 Western Blot analysis of NAT5 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NAT5 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — NAT5
Entrez GeneID
51126GeneBank Accession#
BC005181Protein Accession#
AAH05181Gene Name
NAT5
Gene Alias
NAT3, dJ1002M8.1
Gene Description
N-acetyltransferase 5 (GCN5-related, putative)
Omim ID
610833Gene Ontology
HyperlinkGene Summary
NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM
Other Designations
N-acetyltransferase 3 homolog|N-acetyltransferase 5|N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae)|N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog)|N-terminal acetyltransferase complex ARD1 subunit|OTTHUMP00000030374|d
-
Interactome
-
Pathway
-
Publication Reference
-
N-terminal acetylation can stabilize proteins independent of their ubiquitination.
Bert van de Kooij, Evert de Vries, Rogier W Rooswinkel, George M C Janssen, Frédérique K Kok, Peter A van Veelen, Jannie Borst.
Scientific Reports 2023 Apr; 13(1):5333.
Application:WB-Ce, Human, HEK 293T cells.
-
N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R.
PNAS 2012 Jul; 109(31):12449.
Application:IP, WB, Human , HeLa cells.
-
Identification of the human Nalpha-acetyltransferase complex B (hNatB) - a complex important for cell cycle progression.
Starheim KK, Arnesen T, Gromyko D, Ryningen A, Varhaug JE, Lillehaug J.
The Biochemical Journal 2008 Oct; 415(2):325.
Application:WB, Human, CAL-62, HeLa, HCT-116, HEK 293 cells.
-
N-terminal acetylation can stabilize proteins independent of their ubiquitination.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com