MRPS2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MRPS2 MaxPab polyclonal antibody. Western Blot analysis of MRPS2 expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of MRPS2 expression in transfected 293T cell line (H00051116-T01) by MRPS2 MaxPab polyclonal antibody.
Lane 1: MRPS2 transfected lysate(32.67 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPS2 protein.
Immunogen
MRPS2 (AAH08017, 1 a.a. ~ 296 a.a) full-length human protein.
Sequence
MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQSSYLIGNMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (70)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MRPS2 MaxPab polyclonal antibody. Western Blot analysis of MRPS2 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of MRPS2 expression in transfected 293T cell line (H00051116-T01) by MRPS2 MaxPab polyclonal antibody.
Lane 1: MRPS2 transfected lysate(32.67 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPS2
Entrez GeneID
51116GeneBank Accession#
BC008017Protein Accession#
AAH08017Gene Name
MRPS2
Gene Alias
CGI-91, MRP-S2, S2mt
Gene Description
mitochondrial ribosomal protein S2
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S2 family. [provided by RefSeq
Other Designations
OTTHUMP00000022545|mitochondrial 28S ribosomal protein S2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com