Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RDH11 (Human) Recombinant Protein (P01)

  • Catalog # : H00051109-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RDH11 full-length ORF ( AAH00112, 24 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 58.19
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051109-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RDH11
  • Gene Alias:
  • ARSDR1,CGI-82,FLJ32633,HCBP12,MDT1,PSDR1,RALR1,SCALD,SDR7C1
  • Gene Description:
  • retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
  • Gene Summary:
  • RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.[supplied by OMIM
  • Other Designations:
  • HCV core-binding protein,androgen-regulated short-chain dehydrogenase/reductase 1,prostate short-chain dehydrogenase reductase 1,retinol dehydrogenase 11,retinol dehydrogenase 11 (all-trans and 9-cis),short chain dehydrogenase/reductase family 7C, member
  • RSS
  • YouTube
  • Linkedin
  • Facebook