Product Browser

Last updated: 2022/8/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

RDH11 monoclonal antibody (M01), clone 1H6 

  • Catalog # : H00051109-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant RDH11.
  • Immunogen:
  • RDH11 (AAH00112, 24 a.a. ~ 318 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 lambda
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051109-M01
    Western Blot detection against Immunogen (58.19 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (86); Rat (83)
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RDH11 monoclonal antibody (M01), clone 1H6 Western Blot analysis of RDH11 expression in Hela ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RDH11
  • Gene Alias:
  • ARSDR1,CGI-82,FLJ32633,HCBP12,MDT1,PSDR1,RALR1,SCALD,SDR7C1
  • Gene Description:
  • retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
  • Gene Summary:
  • RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.[supplied by OMIM
  • Other Designations:
  • HCV core-binding protein,androgen-regulated short-chain dehydrogenase/reductase 1,prostate short-chain dehydrogenase reductase 1,retinol dehydrogenase 11,retinol dehydrogenase 11 (all-trans and 9-cis),short chain dehydrogenase/reductase family 7C, member
  • RSS
  • YouTube
  • Linkedin
  • Facebook