Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MECR MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00051102-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human MECR protein.
  • Immunogen:
  • MECR (NP_057095.2, 1 a.a. ~ 373 a.a) full-length human protein.
  • Sequence:
  • MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MECR expression in transfected 293T cell line (H00051102-T01) by MECR MaxPab polyclonal antibody.

    Lane 1: MECR transfected lysate(40.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of MECR transfected lysate using anti-MECR MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MECR purified MaxPab mouse polyclonal antibody (B01P) (H00051102-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MECR
  • Gene Alias:
  • CGI-63,FASN2B,NRBF1
  • Gene Description:
  • mitochondrial trans-2-enoyl-CoA reductase
  • Other Designations:
  • OTTHUMP00000065098,OTTHUMP00000065099,homolog of yeast 2-enoyl thioester reductase,mitochondrial 2-enoyl thioester reductase,nuclear receptor binding factor 1,trans-2-enoyl-CoA reductase, mitochondrial
  • RSS
  • YouTube
  • Linkedin
  • Facebook