GMNN monoclonal antibody (M01J), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody (M01J), clone 1A8.
Lane 1: GMNN transfected lysate (Predicted MW: 23.6 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GMNN is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to GMNN on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GMNN.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
GMNN (AAH05185.1, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (75)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody (M01J), clone 1A8.
Lane 1: GMNN transfected lysate (Predicted MW: 23.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GMNN is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GMNN on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — GMNN
Entrez GeneID
51053GeneBank Accession#
BC005185.1Protein Accession#
AAH05185.1Gene Name
GMNN
Gene Alias
Gem, RP3-369A17.3
Gene Description
geminin, DNA replication inhibitor
Omim ID
602842Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000039393|geminin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com