GMNN monoclonal antibody (M01), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GMNN.
Immunogen
GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (75)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody (M01), clone 1A8.
Lane 1: GMNN transfected lysate(23.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GMNN is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GMNN on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — GMNN
-
Interactome
-
Disease
-
Publication Reference
-
BRCA1 Mutational Complementation Induces Synthetic Viability.
Joseph Nacson, Daniela Di Marcantonio, Yifan Wang, Andrea J Bernhardy, Emma Clausen, Xiang Hua, Kathy Q Cai, Esteban Martinez, Wanjuan Feng, Elsa Callén, Wei Wu, Gaorav P Gupta, Joseph R Testa, André Nussenzweig, Stephen M Sykes, Neil Johnson.
Molecular Cell 2020 Jun; 78(5):951.
Application:IF, Human, MDA-MB-436 cells.
-
BRCA1 Mutation-Specific Responses to 53BP1 Loss-Induced Homologous Recombination and PARP Inhibitor Resistance.
Nacson J, Krais JJ, Bernhardy AJ, Clausen E, Feng W, Wang Y, Nicolas E, Cai KQ, Tricarico R, Hua X, DiMarcantonio D, Martinez E, Zong D, Handorf EA, Bellacosa A, Testa JR, Nussenzweig A, Gupta GP, Sykes SM, Johnson N.
Cell Reports 2018 Sep; 24(13):3513.
Application:IF, Human, MDA-MB-231 cells.
-
The BRCA1-Δ11q Alternative Splice Isoform Bypasses Germline Mutations and Promotes Therapeutic Resistance to PARP Inhibition and Cisplatin.
Wang Y, Bernhardy AJ, Cruz C, Krais JJ, Nacson J, Nicolas E, Peri S, van der Gulden H, van der Hejiden I, O'Brien SW, Zhang Y, Harrell MI, Johnson SF, Candido Dos Reis FJ, Pharoah PD, Karlan B, Gourley C, Lambrechts D, Chenevix-Trench G, Olsson H, Benitez JJ, Greene MH, Gore M, Nussbaum R, Sadetzki S, Gayther SA, Kjaer SK, D'Andrea AD, Shapiro GI, Wiest DL, Connolly DC, Daly MB, Swisher EM, Bouwman P, Jonkers J, Balmana J, Serra V, Johnson N.
Cancer Research 2016 May; 76(9):2778.
Application:IF, Human, MDA-MB-231 cells.
-
BRCA1 Mutational Complementation Induces Synthetic Viability.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com