PI15 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PI15 expression in transfected 293T cell line (H00051050-T01) by PI15 MaxPab polyclonal antibody.
Lane 1: PI15 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PI15 protein.
Immunogen
PI15 (NP_056970.1, 1 a.a. ~ 258 a.a) full-length human protein.
Sequence
MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PI15 expression in transfected 293T cell line (H00051050-T01) by PI15 MaxPab polyclonal antibody.
Lane 1: PI15 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PI15
Entrez GeneID
51050GeneBank Accession#
NM_015886.3Protein Accession#
NP_056970.1Gene Name
PI15
Gene Alias
CRISP8, DKFZp686F0366, P24TI, P25TI
Gene Description
peptidase inhibitor 15
Omim ID
607076Gene Ontology
HyperlinkGene Summary
This gene encodes a trypsin inhibitor. The protein shares similarity to insect venom allergens, mammalian testis-specific proteins and plant pathogenesis-related proteins. It is frequently expressed in human neuroblastoma and glioblastoma cell lines, and thus may play a role in the central nervous system. [provided by RefSeq
Other Designations
25 kDa trypsin inhibitor|protease inhibitor 15
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com