ZBTB7B monoclonal antibody (M03), clone 1D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ZBTB7B monoclonal antibody (M03), clone 1D4. Western Blot analysis of ZBTB7B expression in HeLa.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZBTB7B is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZBTB7B.
Immunogen
ZBTB7B (NP_056956.1, 433 a.a. ~ 537 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ZBTB7B monoclonal antibody (M03), clone 1D4. Western Blot analysis of ZBTB7B expression in HeLa.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZBTB7B is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ZBTB7B
Entrez GeneID
51043GeneBank Accession#
NM_015872Protein Accession#
NP_056956.1Gene Name
ZBTB7B
Gene Alias
DKFZp686G01254, THPOK, ZBTB15, ZFP67, ZNF857B, c-Krox, hcKrox
Gene Description
zinc finger and BTB domain containing 7B
Omim ID
607646Gene Ontology
HyperlinkGene Summary
ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM
Other Designations
OTTHUMP00000035544|OTTHUMP00000035545|kruppel-related zinc finger protein hcKrox|zinc finger and BTB domain containing 15|zinc finger protein 67 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com