FIS1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FIS1 full-length ORF ( AAH03540.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.46
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FIS1
Entrez GeneID
51024GeneBank Accession#
BC003540Protein Accession#
AAH03540.1Gene Name
FIS1
Gene Alias
CGI-135, TTC11
Gene Description
fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Omim ID
609003Gene Ontology
HyperlinkGene Summary
The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM
Other Designations
H_NH0132A01.6|tetratricopeptide repeat domain 11
-
Interactome
-
Publication Reference
-
Human Fis1 regulates mitochondrial dynamics through inhibition of the fusion machinery.
Yu R, Jin SB, Lendahl U, Nistér M, Zhao J.
The EMBO Journal 2019 Apr; 38(8):e99748.
Application:Func, WB-Tr, Human, HEK 293T cells.
-
Human Fis1 regulates mitochondrial dynamics through inhibition of the fusion machinery.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com