Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GLRX2 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00051022-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GLRX2 protein.
  • Immunogen:
  • GLRX2 (NP_932066.1, 1 a.a. ~ 164 a.a) full-length human protein.
  • Sequence:
  • MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GLRX2 expression in transfected 293T cell line (H00051022-T02) by GLRX2 MaxPab polyclonal antibody.

    Lane 1: GLRX2 transfected lysate(18.04 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • GLRX2
  • Gene Alias:
  • GRX2,bA101E13.1
  • Gene Description:
  • glutaredoxin 2
  • Gene Summary:
  • Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000033766,OTTHUMP00000033767,bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook