Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GLRX2 polyclonal antibody (A01)

  • Catalog # : H00051022-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant GLRX2.
  • Immunogen:
  • GLRX2 (AAH28113, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051022-A01
    Western Blot detection against Immunogen (39.75 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GLRX2
  • Gene Alias:
  • GRX2,bA101E13.1
  • Gene Description:
  • glutaredoxin 2
  • Gene Summary:
  • Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000033766,OTTHUMP00000033767,bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook