EXOSC3 monoclonal antibody (M03), clone 5C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EXOSC3 monoclonal antibody (M03), clone 5C3 Western Blot analysis of EXOSC3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of EXOSC3 expression in transfected 293T cell line by EXOSC3 monoclonal antibody (M03), clone 5C3.
Lane 1: EXOSC3 transfected lysate (Predicted MW: 29.6 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EXOSC3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of EXOSC3 transfected lysate using anti-EXOSC3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EXOSC3 monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EXOSC3 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (55.99 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant EXOSC3.
Immunogen
EXOSC3 (AAH02437, 1 a.a. ~ 275 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EXOSC3 monoclonal antibody (M03), clone 5C3 Western Blot analysis of EXOSC3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of EXOSC3 expression in transfected 293T cell line by EXOSC3 monoclonal antibody (M03), clone 5C3.
Lane 1: EXOSC3 transfected lysate (Predicted MW: 29.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EXOSC3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of EXOSC3 transfected lysate using anti-EXOSC3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EXOSC3 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EXOSC3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — EXOSC3
Entrez GeneID
51010GeneBank Accession#
BC002437Protein Accession#
AAH02437Gene Name
EXOSC3
Gene Alias
CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, hRrp40p, p10
Gene Description
exosome component 3
Omim ID
606489Gene Ontology
HyperlinkOther Designations
OTTHUMP00000021392|exosome component Rrp40
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com