TBX22 monoclonal antibody (M01), clone 1A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TBX22 expression in transfected 293T cell line by TBX22 monoclonal antibody (M01), clone 1A10.
Lane 1: TBX22 transfected lysate (Predicted MW: 57.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TBX22 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TBX22 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TBX22.
Immunogen
TBX22 (NP_058650, 431 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (73)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TBX22 expression in transfected 293T cell line by TBX22 monoclonal antibody (M01), clone 1A10.
Lane 1: TBX22 transfected lysate (Predicted MW: 57.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TBX22 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TBX22 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — TBX22
Entrez GeneID
50945GeneBank Accession#
NM_016954Protein Accession#
NP_058650Gene Name
TBX22
Gene Alias
CLPA, TBXX, dJ795G23.1
Gene Description
T-box 22
Gene Ontology
HyperlinkGene Summary
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene have been associated with the inherited X-linked disorder, Cleft palate with ankyloglossia, and it is believed to play a major role in human palatogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023602|OTTHUMP00000023603|OTTHUMP00000023604
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com