RNF141 monoclonal antibody (M01), clone 6D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
RNF141 monoclonal antibody (M01), clone 6D9 Western Blot analysis of RNF141 expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RNF141 expression in transfected 293T cell line by RNF141 monoclonal antibody (M01), clone 6D9.
Lane 1: RNF141 transfected lysate(25.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF141 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF141 monoclonal antibody (M01), clone 6D9 (Cat # H00050862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF141.
Immunogen
RNF141 (NP_001008563, 141 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
RNF141 monoclonal antibody (M01), clone 6D9 Western Blot analysis of RNF141 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RNF141 expression in transfected 293T cell line by RNF141 monoclonal antibody (M01), clone 6D9.
Lane 1: RNF141 transfected lysate(25.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF141 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF141 monoclonal antibody (M01), clone 6D9 (Cat # H00050862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RNF141
Entrez GeneID
50862GeneBank Accession#
NM_016422Protein Accession#
NP_001008563Gene Name
RNF141
Gene Alias
MGC8715, ZFP26, ZNF230
Gene Description
ring finger protein 141
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis. [provided by RefSeq
Other Designations
C3HC4-like zinc finger protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com