TAS2R10 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human TAS2R10 full-length ORF ( AAH63585, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLRVVKGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWIVITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKMKNDTVWDLNMYKSEYFIKQILLNLGVIFFLTLSLITCIFLIISLWGHNR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.29
Interspecies Antigen Sequence
Mouse (56); Rat (55)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAS2R10
Entrez GeneID
50839GeneBank Accession#
CN836251Protein Accession#
AAH63585Gene Name
TAS2R10
Gene Alias
MGC126811, MGC126813, T2R10, TRB2
Gene Description
taste receptor, type 2, member 10
Omim ID
604791Gene Ontology
HyperlinkGene Summary
This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13. [provided by RefSeq
Other Designations
taste receptor, family B, member 2
-
Interactomes
-
Pathways
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com