Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DDEF1 monoclonal antibody (M02), clone 1B5

  • Catalog # : H00050807-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DDEF1.
  • Immunogen:
  • DDEF1 (NP_060952, 1030 a.a. ~ 1129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00050807-M02
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DDEF1 monoclonal antibody (M02), clone 1B5. Western Blot analysis of DDEF1 expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DDEF1 monoclonal antibody (M02), clone 1B5. Western Blot analysis of DDEF1 expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ASAP1
  • Gene Alias:
  • AMAP1,CENTB4,DDEF1,KIAA1249,PAG2,PAP,ZG14P
  • Gene Description:
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  • Other Designations:
  • centaurin, beta 4,development and differentiation enhancing factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook