ARHGEF3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ARHGEF3.
Immunogen
ARHGEF3 (NP_062455, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Sequence
EPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — ARHGEF3
Entrez GeneID
50650GeneBank Accession#
NM_019555Protein Accession#
NP_062455Gene Name
ARHGEF3
Gene Alias
DKFZp434F2429, FLJ98126, GEF3, MGC118905, STA3, XPLN
Gene Description
Rho guanine nucleotide exchange factor (GEF) 3
Gene Ontology
HyperlinkGene Summary
Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
59.8 kDA protein|Rho guanine nucleotide exchange factor 3|RhoGEF protein|exchange factor found in platelets and leukemic and neuronal tissues, XPLN
-
Interactome
-
Disease
-
Publication Reference
-
ARHGEF3 controls HDACi-induced differentiation via RhoA-dependent pathways in acute myeloid leukemias.
D'Amato L, Dell'Aversana C, Conte M, Ciotta A, Scisciola L, Carissimo A, Nebbioso A, Altucci L.
Epigenetics 2015 Jan; 10(1):6.
Application:IF, WB-Ce, Human, U937 cells.
-
ARHGEF3 controls HDACi-induced differentiation via RhoA-dependent pathways in acute myeloid leukemias.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com