Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CALY (Human) Recombinant Protein (P01)

  • Catalog # : H00050632-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CALY full-length ORF (AAH38978.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50.27
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CALY
  • Gene Alias:
  • DRD1IP,NSG3
  • Gene Description:
  • calcyon neuron-specific vesicular protein
  • Gene Summary:
  • The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq
  • Other Designations:
  • D1 dopamine receptor-interacting protein,OTTHUMP00000020793,calcyon D1 dopamine receptor-interacting protein (CALCYON),calcyon protein,dopamine receptor D1 interacting protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook