Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITSN2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00050618-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ITSN2 partial ORF ( NP_006268, 471 a.a. - 571 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NQKNREQEEIVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00050618-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ITSN2
  • Gene Alias:
  • KIAA1256,PRO2015,SH3D1B,SH3P18,SWA,SWAP
  • Gene Description:
  • intersectin 2
  • Gene Summary:
  • This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis. Alternatively spliced transcript variants have been found for this gene that encode three distinct isoforms. Additional variants have been found but their full length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • SH3 domain protein 1B,SH3P18-like WASP associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook