IL20 monoclonal antibody (M01), clone 2H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
IL20 monoclonal antibody (M01), clone 2H8. Western Blot analysis of IL20 expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
IL20 monoclonal antibody (M01), clone 2H8 Western Blot analysis of IL20 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of IL20 expression in transfected 293T cell line by IL20 monoclonal antibody (M01), clone 2H8.
Lane 1: IL20 transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IL20 transfected lysate using anti-IL20 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL20 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL20 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IL20.
Immunogen
IL20 (NP_061194, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (74)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IL20 monoclonal antibody (M01), clone 2H8. Western Blot analysis of IL20 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
IL20 monoclonal antibody (M01), clone 2H8 Western Blot analysis of IL20 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of IL20 expression in transfected 293T cell line by IL20 monoclonal antibody (M01), clone 2H8.
Lane 1: IL20 transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of IL20 transfected lysate using anti-IL20 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL20 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL20 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — IL20
Entrez GeneID
50604GeneBank Accession#
NM_018724Protein Accession#
NP_061194Gene Name
IL20
Gene Alias
IL-20, IL10D, MGC96907, ZCYTO10
Gene Description
interleukin 20
Omim ID
605619Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq
Other Designations
OTTHUMP00000034617|OTTHUMP00000034618|four alpha helix cytokine
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com