Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL20 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00050604-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human IL20 protein.
  • Immunogen:
  • IL20 (NP_061194.2, 1 a.a. ~ 176 a.a) full-length human protein.
  • Sequence:
  • MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IL20 expression in transfected 293T cell line (H00050604-T02) by IL20 MaxPab polyclonal antibody.

    Lane 1: IL20 transfected lysate(19.36 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • IL20
  • Gene Alias:
  • IL-20,IL10D,MGC96907,ZCYTO10
  • Gene Description:
  • interleukin 20
  • Gene Summary:
  • The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034617,OTTHUMP00000034618,four alpha helix cytokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook