Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLA2G3 polyclonal antibody (A01)

  • Catalog # : H00050487-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PLA2G3.
  • Immunogen:
  • PLA2G3 (NP_056530, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQACSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00050487-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PLA2G3
  • Gene Alias:
  • GIII-SPLA2,SPLA2III
  • Gene Description:
  • phospholipase A2, group III
  • Gene Summary:
  • PLA2G3 belongs to the family of secreted phospholipase A2 (sPLA2; EC 3.1.1.4) proteins. These Ca(2+)-dependent lipolytic enzymes have a conserved Ca(2+)-binding loop and a his-asp dyad in the catalytic site (Murakami et al., 2003 [PubMed 12522102]).[supplied by OMIM
  • Other Designations:
  • group III secreted phospholipase A2,phosphatidylcholine 2-acylhydrolase GIII
  • RSS
  • YouTube
  • Linkedin
  • Facebook