Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RRM2B monoclonal antibody (M01), clone 6C1

  • Catalog # : H00050484-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RRM2B.
  • Immunogen:
  • RRM2B (NP_056528, 3 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00050484-M01
    Western Blot detection against Immunogen (34.76 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RRM2B
  • Gene Alias:
  • DKFZp686M05248,MGC102856,MGC42116,p53R2
  • Gene Description:
  • ribonucleotide reductase M2 B (TP53 inducible)
  • Other Designations:
  • p53-inducible ribonucleotide reductase small subunit 2 homolog,p53-inducible ribonucleotide reductase small subunit 2 long form,p53-inducible ribonucleotide reductase small subunit 2 short form gamma
  • RSS
  • YouTube
  • Linkedin
  • Facebook