KLK12 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KLK12 full-length ORF ( NP_665902.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGRPIPGSAPVPQPLHRLPCHLPWCVSRENHEQHGVCRRRPGAGCLPG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.4
Interspecies Antigen Sequence
Mouse (71); Rat (37)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KLK12
Entrez GeneID
43849GeneBank Accession#
NM_145895.1Protein Accession#
NP_665902.1Gene Name
KLK12
Gene Alias
DKFZp686H1078, KLK-L5, KLKL5, MGC42603
Gene Description
kallikrein-related peptidase 12
Omim ID
605539Gene Ontology
HyperlinkGene Summary
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
kallikrein 12|kallikrein-like protein 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com