PIK3R4 monoclonal antibody (M02), clone 1B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Immunogen
PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PIK3R4 monoclonal antibody (M02), clone 1B5 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PIK3R4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.6 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIK3R4 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PIK3R4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PIK3R4
Entrez GeneID
30849GeneBank Accession#
NM_014602Protein Accession#
NP_055417Gene Name
PIK3R4
Gene Alias
MGC102700, VPS15, p150
Gene Description
phosphoinositide-3-kinase, regulatory subunit 4
Omim ID
602610Gene Ontology
HyperlinkGene Summary
O
Other Designations
phosphatidylinositol 3-kinase-associated p150|phosphoinositide-3-kinase, regulatory subunit 4, p150
-
Interactome
-
Pathway
-
Publication Reference
-
Class 3 PI3K coactivates the circadian clock to promote rhythmic de novo purine synthesis.
Chantal Alkhoury, Nathaniel F Henneman, Volodymyr Petrenko, Yui Shibayama, Arianna Segaloni, Alexis Gadault, Ivan Nemazanyy, Edouard Le Guillou, Amare Desalegn Wolide, Konstantina Antoniadou, Xin Tong, Teruya Tamaru, Takeaki Ozawa, Muriel Girard, Karim Hnia, Dominik Lutter, Charna Dibner, Ganna Panasyuk.
Nature Cell Biology 2023 Jul; 25(7):975.
Application:ChIP, IP, IF, WB, Human, Mouse, AML12, HEK293T, MEF, Mouse hepatocytes, Mouse liver.
-
Neuronal lysosomal dysfunction releases exosomes harboring APP C-terminal fragments and unique lipid signatures.
Miranda AM, Lasiecka ZM, Xu Y, Neufeld J, Shahriar S, Simoes S, Chan RB, Oliveira TG, Small SA, Di Paolo G.
Nature Communications 2018 Jan; 9(1):291.
Application:WB, Mouse, Mouse cortical neurons.
-
Autophagy dysregulation in Danon disease.
Nascimbeni AC, Fanin M, Angelini C, Sandri M.
Cell Death & Disease 2017 Jan; 8(1):e2565.
Application:IF, WB-Ti, Human, Muscle biopsies from patients with Danon Disease (DD) and glycogen storage disease type II (GSDII).
-
Insulin activation of vacuolar protein sorting 34 mediates localized phosphatidylinositol 3-phosphate production at lamellipodia and activation of mTOR/S6K1.
Hirsch DS, Shen Y, Dokmanovic M, Yu J, Mohan N, Elzarrad MK, Wu WJ.
Cellular Signalling 2014 Jun; 26(6):1258.
Application:IF, WB-Tr, Mouse, Monkey, NIH/3T3, COS-7 cells.
-
Regulation of Mammalian Autophagy by Class II and III PI 3-Kinases through PI3P Synthesis.
Devereaux K.
PLoS One 2013 Oct; 8(10):e76405.
Application:WB-Ce, Mouse, MEFs.
-
Class 3 PI3K coactivates the circadian clock to promote rhythmic de novo purine synthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com