Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNRD1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00030834-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ZNRD1 partial ORF ( NP_055411, 24 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.07
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00030834-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ZNRD1
  • Gene Alias:
  • HTEX-6,MGC13376,Rpa12,TEX6,hZR14,tctex-6
  • Gene Description:
  • zinc ribbon domain containing 1
  • Gene Summary:
  • This gene encodes a protein with similarity to the Saccharomyces cerevisiae Rpa12p subunit of RNA polymerase I. Alternate splicing of this gene results in two transcript variants encoding the same protein. Additional splice variants have been described, but their full-length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029203,OTTHUMP00000029204,OTTHUMP00000161285,OTTHUMP00000161286,RNA polymerase I small specific subunit Rpa12,transcription-associated zinc ribbon protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook