ZNRD1 monoclonal antibody (M01), clone 6C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZNRD1 expression in transfected 293T cell line by ZNRD1 monoclonal antibody (M01), clone 6C12.
Lane 1: ZNRD1 transfected lysate(13.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNRD1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNRD1.
Immunogen
ZNRD1 (NP_055411, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNRD1 expression in transfected 293T cell line by ZNRD1 monoclonal antibody (M01), clone 6C12.
Lane 1: ZNRD1 transfected lysate(13.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNRD1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ZNRD1
Entrez GeneID
30834GeneBank Accession#
NM_014596Protein Accession#
NP_055411Gene Name
ZNRD1
Gene Alias
HTEX-6, MGC13376, Rpa12, TEX6, hZR14, tctex-6
Gene Description
zinc ribbon domain containing 1
Omim ID
607525Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with similarity to the Saccharomyces cerevisiae Rpa12p subunit of RNA polymerase I. Alternate splicing of this gene results in two transcript variants encoding the same protein. Additional splice variants have been described, but their full-length sequences have not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000029203|OTTHUMP00000029204|OTTHUMP00000161285|OTTHUMP00000161286|RNA polymerase I small specific subunit Rpa12|transcription-associated zinc ribbon protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com