Product Browser

Last updated: 2017/9/24
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNRD1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00030834-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ZNRD1 protein.
  • Immunogen:
  • ZNRD1 (NP_055411.1, 1 a.a. ~ 126 a.a) full-length human protein.
  • Sequence:
  • MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ZNRD1 expression in transfected 293T cell line (H00030834-T01) by ZNRD1 MaxPab polyclonal antibody.

    Lane 1: ZNRD1 transfected lysate(13.86 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ZNRD1
  • Gene Alias:
  • HTEX-6,MGC13376,Rpa12,TEX6,hZR14,tctex-6
  • Gene Description:
  • zinc ribbon domain containing 1
  • Gene Summary:
  • This gene encodes a protein with similarity to the Saccharomyces cerevisiae Rpa12p subunit of RNA polymerase I. Alternate splicing of this gene results in two transcript variants encoding the same protein. Additional splice variants have been described, but their full-length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029203,OTTHUMP00000029204,OTTHUMP00000161285,OTTHUMP00000161286,RNA polymerase I small specific subunit Rpa12,transcription-associated zinc ribbon protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook