Product Browser

Last updated: 2017/7/16
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNRD1 polyclonal antibody (A01)

  • Catalog # : H00030834-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ZNRD1.
  • Immunogen:
  • ZNRD1 (NP_055411, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00030834-A01
    Western Blot detection against Immunogen (37.44 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ZNRD1
  • Gene Alias:
  • HTEX-6,MGC13376,Rpa12,TEX6,hZR14,tctex-6
  • Gene Description:
  • zinc ribbon domain containing 1
  • Gene Summary:
  • This gene encodes a protein with similarity to the Saccharomyces cerevisiae Rpa12p subunit of RNA polymerase I. Alternate splicing of this gene results in two transcript variants encoding the same protein. Additional splice variants have been described, but their full-length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029203,OTTHUMP00000029204,OTTHUMP00000161285,OTTHUMP00000161286,RNA polymerase I small specific subunit Rpa12,transcription-associated zinc ribbon protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook