NT5C purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NT5C expression in transfected 293T cell line (H00030833-T01) by NT5C MaxPab polyclonal antibody.
Lane 1: NT5C transfected lysate(12.87 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to NT5C on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NT5C on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NT5C protein.
Immunogen
NT5C (AAH08183.1, 1 a.a. ~ 117 a.a) full-length human protein.
Sequence
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKVWLPRPYSARGAA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NT5C expression in transfected 293T cell line (H00030833-T01) by NT5C MaxPab polyclonal antibody.
Lane 1: NT5C transfected lysate(12.87 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to NT5C on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NT5C on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NT5C
Entrez GeneID
30833GeneBank Accession#
BC008183.1Protein Accession#
AAH08183.1Gene Name
NT5C
Gene Alias
DNT, DNT1, P5N2, PN-I, PN-II, UMPH2, cdN, dNT-1
Gene Description
5', 3'-nucleotidase, cytosolic
Omim ID
191720Gene Ontology
HyperlinkGene Summary
Pyrimidine 5-prime nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1; MIM 606224) and type II (UMPH2).[supplied by OMIM
Other Designations
5' nucleotidase, deoxy (pyrimidine), cytosolic type C|5',3'-nucleotidase, cytosolic|uridine 5'-monophosphate phosphohydrolase 2|uridine 5-prime monophosphate hydrolase 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com