KCNIP2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNIP2 partial ORF ( AAH34685, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNIP2
Entrez GeneID
30819GeneBank Accession#
BC034685Protein Accession#
AAH34685Gene Name
KCNIP2
Gene Alias
DKFZp566L1246, KCHIP2, MGC17241
Gene Description
Kv channel interacting protein 2
Omim ID
604661Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq
Other Designations
A-type potassium channel modulatory protein 2|Kv channel-interacting protein 2|OTTHUMP00000020332|OTTHUMP00000020333|OTTHUMP00000020336|OTTHUMP00000020337|OTTHUMP00000020339|OTTHUMP00000020340|cardiac voltage gated potassium channel modulatory subunit|pot
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com