KCNIP2 monoclonal antibody (M01), clone 3E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KCNIP2.
Immunogen
KCNIP2 (AAH34685, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KCNIP2 expression in transfected 293T cell line by KCNIP2 monoclonal antibody (M01), clone 3E7.
Lane 1: KCNIP2 transfected lysate(30.919 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KCNIP2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of KCNIP2 over-expressed 293 cell line, cotransfected with KCNIP2 Validated Chimera RNAi ( Cat # H00030819-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNIP2 monoclonal antibody (M01), clone 3E7 (Cat # H00030819-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — KCNIP2
Entrez GeneID
30819GeneBank Accession#
BC034685Protein Accession#
AAH34685Gene Name
KCNIP2
Gene Alias
DKFZp566L1246, KCHIP2, MGC17241
Gene Description
Kv channel interacting protein 2
Omim ID
604661Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq
Other Designations
A-type potassium channel modulatory protein 2|Kv channel-interacting protein 2|OTTHUMP00000020332|OTTHUMP00000020333|OTTHUMP00000020336|OTTHUMP00000020337|OTTHUMP00000020339|OTTHUMP00000020340|cardiac voltage gated potassium channel modulatory subunit|pot
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com