KCNIP2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
KCNIP2 MaxPab polyclonal antibody. Western Blot analysis of KCNIP2 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of KCNIP2 expression in transfected 293T cell line (H00030819-T01) by KCNIP2 MaxPab polyclonal antibody.
Lane 1: KCNIP2 transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to KCNIP2 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human KCNIP2 protein.
Immunogen
KCNIP2 (NP_775283.1, 1 a.a. ~ 270 a.a) full-length human protein.
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
KCNIP2 MaxPab polyclonal antibody. Western Blot analysis of KCNIP2 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of KCNIP2 expression in transfected 293T cell line (H00030819-T01) by KCNIP2 MaxPab polyclonal antibody.
Lane 1: KCNIP2 transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to KCNIP2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — KCNIP2
Entrez GeneID
30819GeneBank Accession#
NM_173191.2Protein Accession#
NP_775283.1Gene Name
KCNIP2
Gene Alias
DKFZp566L1246, KCHIP2, MGC17241
Gene Description
Kv channel interacting protein 2
Omim ID
604661Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq
Other Designations
A-type potassium channel modulatory protein 2|Kv channel-interacting protein 2|OTTHUMP00000020332|OTTHUMP00000020333|OTTHUMP00000020336|OTTHUMP00000020337|OTTHUMP00000020339|OTTHUMP00000020340|cardiac voltage gated potassium channel modulatory subunit|pot
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com