ERVWE1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ERVWE1 partial ORF ( NP_055405, 116 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEVSAQNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ERVWE1
Entrez GeneID
30816GeneBank Accession#
NM_014590Protein Accession#
NP_055405Gene Name
ERVWE1
Gene Alias
Env-W, HERV-7q, HERV-W, HERV-W-ENV, HERVW, env, syncytin
Gene Description
endogenous retroviral family W, env(C7), member 1
Omim ID
604659Gene Ontology
HyperlinkGene Summary
Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The product of this gene, syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
HERV-7q envelope protein|HERV-W Env glycoprotein|HERV-W{7q21.1} provirus ancestral Env polyprotein|HERV-tryptophan envelope protein|OTTHUMP00000161914|envelope glycoprotein|envelope protein|enverin|syncytin|syncytin-1
-
Disease
-
Publication Reference
-
Immune cell activation by trophoblast-derived microvesicles is mediated by syncytin 1.
Holder BS, Tower CL, Forbes K, Mulla MJ, Aplin JD, Abrahams VM.
Immunology 2012 Jun; 136(2):184.
Application:Func, Recombinant protein.
-
Immune cell activation by trophoblast-derived microvesicles is mediated by syncytin 1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com