TLX3 monoclonal antibody (M01), clone 2A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TLX3.
Immunogen
TLX3 (NP_066305, 192 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TLX3 monoclonal antibody (M01), clone 2A3 Western Blot analysis of TLX3 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TLX3 expression in transfected 293T cell line by TLX3 monoclonal antibody (M01), clone 2A3.
Lane 1: TLX3 transfected lysate(31.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TLX3 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TLX3 over-expressed 293 cell line, cotransfected with TLX3 Validated Chimera RNAi ( Cat # H00030012-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TLX3 monoclonal antibody (M01), clone 2A3 (Cat # H00030012-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TLX3
Entrez GeneID
30012GeneBank Accession#
NM_021025Protein Accession#
NP_066305Gene Name
TLX3
Gene Alias
HOX11L2, MGC29804, RNX
Gene Description
T-cell leukemia homeobox 3
Omim ID
604640Gene Ontology
HyperlinkGene Summary
RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain (Dear et al., 1993 [PubMed 8099440]).[supplied by OMIM
Other Designations
T-cell leukemia, homeobox 3|homeo box 11-like 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com