Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH3KBP1 monoclonal antibody (M01), clone 1F11

  • Catalog # : H00030011-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SH3KBP1.
  • Immunogen:
  • SH3KBP1 (NP_114098.1, 224 a.a. ~ 308 a.a) partial recombinant protein with GST-pstS1 tag.
  • Sequence:
  • IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00030011-M01
    Western Blot detection against Immunogen (37.29 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SH3KBP1 monoclonal antibody (M01), clone 1F11. Western Blot analysis of SH3KBP1 expression in IMR-32.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SH3KBP1
  • Gene Alias:
  • CIN85,GIG10,MIG18
  • Gene Description:
  • SH3-domain kinase binding protein 1
  • Gene Summary:
  • CBL (MIM 165360) constitutively interacts with SH3 domain-containing proteins and, upon tyrosine phosphorylation, with SH2 domain-containing proteins. The SH3KBP1 gene encodes an 85-kD CBL-interacting protein that enhances tumor necrosis factor (MIM 191160)-mediated apoptotic cell death (Narita et al., 2001 [PubMed 11474197]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000023022,OTTHUMP00000023024,OTTHUMP00000061480,c-Cbl-interacting protein,migration-inducing gene 18 protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook