Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNPO2 polyclonal antibody (A01)

  • Catalog # : H00030000-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TNPO2.
  • Immunogen:
  • TNPO2 (NP_038461, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MDRAQALMDNIDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLTLAEQPICKEVLASHLVQLIP
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00030000-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TNPO2 polyclonal antibody (A01), Lot # 060619JCS1. Western Blot analysis of TNPO2 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TNPO2 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of TNPO2 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TNPO2
  • Gene Alias:
  • FLJ12155,IPO3,KPNB2B,TRN2
  • Gene Description:
  • transportin 2
  • Other Designations:
  • importin 3,karyopherin beta 2b,karyopherin beta 2b, transportin,transportin 2 (importin 3, karyopherin beta 2b)
  • RSS
  • YouTube
  • Linkedin
  • Facebook