Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBQLN2 polyclonal antibody (A01)

  • Catalog # : H00029978-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant UBQLN2.
  • Immunogen:
  • UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00029978-A01
    Western Blot detection against Immunogen (33.81 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • UBQLN2 polyclonal antibody (A01), Lot # 061101JCS1 Western Blot analysis of UBQLN2 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • UBQLN2
  • Gene Alias:
  • CHAP1,CHAP1/DSK2,Dsk2,HRIHFB2157,LIC-2,N4BP4,PLIC-2,PLIC2,RIHFB2157
  • Gene Description:
  • ubiquilin 2
  • Gene Summary:
  • This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. [provided by RefSeq
  • Other Designations:
  • Nedd4 binding protein 4,bA431N15.1 (ubiquilin 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook