PSAT1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PSAT1.
Immunogen
PSAT1 (NP_478059, 262 a.a. ~ 370 a.a) partial recombinant protein with GST tag.
Sequence
GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.1 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PSAT1 polyclonal antibody (A01), Lot # 051214JCO1 Western Blot analysis of PSAT1 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
PSAT1 polyclonal antibody (A01), Lot # 060814QCS1. Western Blot analysis of PSAT1 expression in MES-SA/Dx5.Western Blot (Recombinant protein)
ELISA
-
Gene Info — PSAT1
Entrez GeneID
29968GeneBank Accession#
NM_058179Protein Accession#
NP_478059Gene Name
PSAT1
Gene Alias
EPIP, MGC1460, PSA, PSAT
Gene Description
phosphoserine aminotransferase 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000021524|OTTHUMP00000021525|endometrial progesterone-induced protein|phosphoserine aminotransferase
-
Interactome
-
Pathway
-
Publication Reference
-
Neurons Release Serine to Support mRNA Translation in Pancreatic Cancer.
Robert S Banh, Douglas E Biancur, Keisuke Yamamoto, Albert S W Sohn, Beth Walters, Miljan Kuljanin, Ajami Gikandi, Huamin Wang, Joseph D Mancias, Robert J Schneider, Michael E Pacold, Alec C Kimmelman.
Cell 2020 Nov; 183(5):1202.
Application:WB, Mouse, PDAC cells.
-
LrrkA, a kinase with leucine-rich repeats, links folate sensing with Kil2 activity and intracellular killing.
Bodinier R, Leiba J, Sabra A, Jauslin TN, Lamrabet O, Guilhen C, Marchetti A, Iwade Y, Kawata T, Lima WC, Cosson P.
Cellular Microbiology 2020 Jan; 22(1):e13129.
Application:WB-Tr, Bacteria, Dictyostelium cells.
-
Cellular redox state constrains serine synthesis and nucleotide production to impact cell proliferation.
Diehl FF, Lewis CA, Fiske BP, Vander Heiden MG.
Nature Metabolism 2019 Sep; 1(9):861.
Application:WB-Ce, Human, A-549, MDA-MB-231, MDA-MB-468 cells.
-
Glutamine-utilizing transaminases are a metabolic vulnerability of TAZ/YAP-activated cancer cells.
Yang CS, Stampouloglou E, Kingston NM, Zhang L, Monti S, Varelas X.
EMBO Reports 2018 Apr; 19(6):e43577.
Application:WB, Human, MDA-MB-231 cells.
-
Neurons Release Serine to Support mRNA Translation in Pancreatic Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com