NRBP1 monoclonal antibody (M01), clone 4D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NRBP1.
Immunogen
NRBP1 (AAH01221, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NRBP monoclonal antibody (M01), clone 4D2 Western Blot analysis of NRBP expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NRBP1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NRBP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NRBP1
Entrez GeneID
29959GeneBank Accession#
BC001221Protein Accession#
AAH01221Gene Name
NRBP1
Gene Alias
BCON3, FLJ27109, FLJ35541, MADM, MUDPNP, NRBP
Gene Description
nuclear receptor binding protein 1
Omim ID
606010Gene Ontology
HyperlinkOther Designations
OTTHUMP00000123427|OTTHUMP00000123428|multiple domain putative nuclear protein|myeloid leukemia factor 1 adaptor molecule|nuclear receptor binding protein
-
Interactome
-
Publication Reference
-
CircLRP6 contributes to prostate cancer growth and metastasis by binding to miR-330-5p to up-regulate NRBP1.
Linghui Qin, Xiaosong Sun, Fei Zhou, Cheng Liu.
World Journal of Surgical Oncology 2021 Jun; 19(1):184.
Application:IHC-P, WB-Tr, Human, Mouse, DU145 cells, Mouse tumors, PC-3 cells.
-
NRBP1-Containing CRL2/CRL4A Regulates Amyloid β Production by Targeting BRI2 and BRI3 for Degradation.
Yasukawa T, Tsutsui A, Tomomori-Sato C, Sato S, Saraf A, Washburn MP, Florens L, Terada T, Shimizu K, Conaway RC, Conaway JW, Aso T.
Cell Reports 2020 Mar; 30(10):3478.
Application:WB-Tr, Human, HeLa cells.
-
High NRBP1 expression promotes proliferation and correlates with poor prognosis in bladder cancer.
Wu Q, Zhou X, Li P, Wang W, Wang J, Tan M, Tao L, Qiu J.
Journal of Cancer 2019 Jul; 10(18):4270.
Application:IHC, WB, Human, Mouse, Bladder, 5637, T24 cells.
-
Nuclear receptor binding protein 1 correlates with better prognosis and induces caspase-dependent intrinsic apoptosis through the JNK signalling pathway in colorectal cancer.
Liao Y, Yang Z, Huang J, Chen H, Xiang J, Li S, Chen C, He X, Lin F, Yang Z, Wang J.
Cell Death & Disease 2018 Mar; 9(4):436.
Application:IHC, WB, Human, Colorectal cancer (CRC) tissue, CRC cells.
-
CircLRP6 contributes to prostate cancer growth and metastasis by binding to miR-330-5p to up-regulate NRBP1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com