RPA4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RPA4 MaxPab polyclonal antibody. Western Blot analysis of RPA4 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of RPA4 expression in transfected 293T cell line (H00029935-T01) by RPA4 MaxPab polyclonal antibody.
Lane 1: RPA4 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RPA4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RPA4 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RPA4 protein.
Immunogen
RPA4 (NP_037479.1, 1 a.a. ~ 261 a.a) full-length human protein.
Sequence
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RPA4 MaxPab polyclonal antibody. Western Blot analysis of RPA4 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of RPA4 expression in transfected 293T cell line (H00029935-T01) by RPA4 MaxPab polyclonal antibody.
Lane 1: RPA4 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RPA4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RPA4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPA4
Entrez GeneID
29935GeneBank Accession#
NM_013347Protein Accession#
NP_037479.1Gene Name
RPA4
Gene Alias
HSU24186, MGC120333, MGC120334
Gene Description
replication protein A4, 34kDa
Gene Ontology
HyperlinkGene Summary
Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. [provided by RefSeq
Other Designations
OTTHUMP00000023647|replication protein A complex 34 kDa subunit RPA4|replication protein A complex 34 kd subunit homolog Rpa4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com