Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNX12 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00029934-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SNX12 protein.
  • Immunogen:
  • SNX12 (N/A, 1 a.a. ~ 172 a.a) full-length human protein.
  • Sequence:
  • MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SNX12 MaxPab rabbit polyclonal antibody. Western Blot analysis of SNX12 expression in mouse kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SNX12 expression in transfected 293T cell line (H00029934-T01) by SNX12 MaxPab polyclonal antibody.

    Lane 1: SNX12 transfected lysate(18.92 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Protein Accession#:
  • N/A
  • Gene Name:
  • SNX12
  • Gene Alias:
  • MGC118982,MGC118983
  • Gene Description:
  • sorting nexin 12
  • Gene Summary:
  • This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023487
  • RSS
  • YouTube
  • Linkedin
  • Facebook